A practical reference on research chemical: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-07-17. Anything still debated is marked as such rather than presented as settled.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
Pharmacokinetic data for SR9009 are limited in published literature. Some reports indicate low oral bioavailability and rapid clearance in animals, which complicates interpretation of exposure and effect. Researchers often use injected routes in preclinical work to achieve measurable systemic levels. Analytical studies rely on mass spectrometry to detect the parent compound and its metabolites. Questions about tissue distribution, active metabolites, and long-term consequences remain open. Species differences in metabolism can affect observed half-life and target engagement.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
Regulatory status varies by country and intended use. Major drug agencies have not granted marketing authorization for SR9009 as a medicine, and it is not listed as a controlled substance in many jurisdictions. It is often sold as a research chemical, a category that may fall outside pharmaceutical manufacturing rules. Buyers should verify local laws and supplier documentation, including certificates of analysis. The lack of standardized quality controls raises concerns about identity, purity, and actual content in products marketed online.
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic small-molecule REV-ERB agonist | Not a hormone or natural product |
| Primary targets | REV-ERBα and REV-ERBβ | Nuclear receptors involved in circadian and metabolic regulation |
| Appearance | White to off-white solid | Typical for purified research samples |
| Solubility | Soluble in DMSO and ethanol; low water solubility | Laboratory solubility depends on solvent and purity |
| Common synonyms | SR9009; Stenabolic | Stenabolic is a colloquial name, not a formal chemical name |
SR9009 is generally described as poorly soluble in water and more soluble in organic solvents such as dimethyl sulfoxide and ethanol. Stock solutions are commonly prepared in an organic solvent before dilution into an aqueous buffer or vehicle. Precipitation can occur if the organic fraction is reduced too quickly or if the final concentration exceeds the compound's solubility limit. Sonication or gentle warming may aid dissolution in some protocols, but excessive heat can promote degradation. Container material and pH can also influence observed solubility.
For long-term storage, SR9009 is typically kept as a solid at low temperature, protected from moisture and light. Desiccated conditions limit hydrolysis, while opaque containers reduce photochemical breakdown. Solutions are less stable than solids and are often stored frozen in aliquots to avoid repeated freeze-thaw cycles. Stability data are not standardized across all suppliers, so users should rely on certificate-of-analysis information when available. Degradation may appear as color change, precipitate, or decreased chromatographic purity.
In an experiment described in the 2016 paper, rhesus macaques were infected with Ebola virus and treated with a combination of ansuvimab and another antibody isolated from the same subject, mAb100. Three doses of the combination were given once a day starting 1 day after the animals were infected. The control animal died and the treated animals all survived. In a second experiment described in the 2016 paper, rhesus macaques were infected with Ebola virus and only treated with ansuvimab. Three doses of ansuvimab were given once a day starting 1 day or 5 days after the animals were infected. The control animals died and the treated animals all survived. Unpublished data referred to in a publication of the 2018 Phase I clinical trial results of ansuvimab, reported that a single infusion of ansuvimab provided full protection of rhesus macaques and was the basis of the dosing used for human studies.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Banting House is a museum and former residence in London, Ontario, Canada. Known as the “Birthplace of Insulin,” it is the house where Sir Frederick Banting woke up at two o'clock in the morning on October 31, 1920 with the idea that led to the discovery of insulin. Since 1984, the house has been a museum dedicated to Banting's discovery and his life. An addition at the back houses the London & District Branch of the Canadian Diabetes Association. For many that have been touched by diabetes, the house is an emotional reminder of Banting's scientific contribution that saved their lives or the lives of their loved ones.
An alcohol burner or spirit lamp is a piece of laboratory equipment used to produce an open flame. It can be made from brass, glass, stainless steel or aluminium. Alcohol burners are preferred for some uses over Bunsen burners for safety purposes, and in laboratories where natural gas is not available. Their flame is limited to approximately 5 centimeters (two inches) in height, with a comparatively lower temperature than the gas flame of the Bunsen burner. While they do not produce flames as hot as other types of burners, they are sufficiently hot for performing some chemistries, standard microbiology laboratory procedures, and can be used for flame sterilization of other laboratory equipment. A small alcohol burner is also preferred for camping when the need for fire is modest. It burns the alcohol vapor that rises due to the heat from the flame through the holes on the top perimeter of the container. Typical fuel is denatured alcohol, methanol, or isopropanol. A cap is used as a snuffer for extinguishing the flame.
3-Dehydrocarnitine is an aliphatic quaternary ammonium betaine that is part of the carnitine family. At physiological pH of 7.3, the major species of 3-dehydrocarnitine is its zwitterionic form, the conjugate base of 3-dehydrocarnitinium. 3-Dehydrocarnitine is classified as a short-chain keto acid, as it has a carbon chain containing less than six carbon atoms. It is an intermediate in carnitine degradation and is formed from D- or L-carnitine. The enzymes responsible for the degradation of carnitine to 3-dehydrocarnitine are carnitine-3-dehydrogenase or (S)-carnitine-3-dehydrogenase.
Sources: en.wikipedia.org
An ion-exchange membrane is generally made of organic or inorganic polymer with charged (ionic) side groups, such as ion-exchange resins. Anion-exchange membranes contain fixed cationic groups with predominantly mobile anions; because anions are the majority species, most of the conductivity is due to anion transport. The reverse holds for cation-exchange membranes. The so-called heterogeneous ion-exchange membranes have low cost and a thicker composition with higher resistance and a rough surface that can be subject to fouling. Homogeneous membranes are more expensive, but have a thinner composition with lower resistance and a smooth surface, less susceptible to fouling. Homogeneous membrane surfaces can be modified to alter the membrane permselectivity to protons, monovalent ions, and divalent ions. The selectivity of an ion-exchange membrane is due to Gibbs-Donnan equilibrium and not due to physically blocking or electrostatically excluding specific charged species. The selectivity to the transport of ions of opposite charges is called its permselectivity.
Pregnant women are advised to pay attention to the foods they eat during pregnancy to reduce the risk of exposure to substances or bacteria that may be harmful to the developing fetus. This can include potentially harmful pathogens such as listeria, toxoplasmosis, and salmonella. Intake of large amounts of retinol has been linked to birth defects and abnormalities. During pregnancy, a woman's mass increases by about 12 kg (26 lb). The European Food Safety Authority recommends an increase of 300 mL per day compared to the normal intake for non-pregnant women, taking the total adequate water intake (from food and fluids) to 2,300 mL, or approximately 1,850 mL/ day from fluids alone.
Biopolymers are natural polymers produced by the cells of living organisms. Like other polymers, biopolymers consist of monomeric units that are covalently bonded in chains to form larger molecules. There are three main classes of biopolymers, classified according to the monomers used and the structure of the biopolymer formed: polynucleotides, polypeptides, and polysaccharides. The polynucleotides, RNA and DNA, are long polymers of nucleotides. Polypeptides include proteins and shorter polymers of amino acids; some major examples include collagen, actin, and fibrin. Polysaccharides are linear or branched chains of sugar carbohydrates; examples include starch, cellulose, and alginate. Other examples of biopolymers include natural rubbers (polymers of isoprene), suberin and lignin (complex polyphenolic polymers), cutin and cutan (complex polymers of long-chain fatty acids), melanin, and polyhydroxyalkanoates (PHAs).
National teams April 29 – May 1: 2018 FIBA 3x3 Asia Cup in Shenzhen Men: Australia defeated Mongolia, 17–16, in the final. Japan took third place. Women: New Zealand defeated China, 14–11, in the final. Australia took third place. August 5 – 11: 2018 FIBA Under-18 Asian Championship in Thailand In the final, Australia defeated New Zealand, 73–62, to win their 1st title. China took third place. Note: All teams mentioned here, plus Philippines, have qualified to compete at the 2019 FIBA Under-19 Basketball World Cup. October 28 – November 3: 2018 FIBA Under-18 Women's Asian Championship in Bangalore China defeated Japan, 89–76, to win their fifth consecutive and 16th overall FIBA Under-18 Women's Asian Championship title. Australia took third place. Note: All teams mentioned here, plus South Korea, have qualified to compete at the 2019 FIBA Under-19 Women's Basketball World Cup. Clubs teams November 17, 2017 – May 2: 2017–18 ABL season San Miguel Alab Pilipinas defeated Mono Vampire, 3–2 in games played in a 5-legged final, to win their first ABL title. July 17 – 22: Summer Super 8 in Macau Guangzhou Long-Lions defeated Seoul Samsung Thunders, 78–72, to win their first title. Incheon Electroland Elephants took third place.
Sources: en.wikipedia.org
It is a synthetic research compound that activates REV-ERB nuclear receptors. It is not an approved drug or dietary supplement. Most information comes from cell and animal studies.
It binds REV-ERBα and REV-ERBβ and changes transcription of metabolic genes. This can affect circadian rhythm, lipid use, and mitochondrial function. The full downstream effects are still under study.
No. Some rodent studies show increased endurance, but controlled human trials are lacking. Claims about human performance are not established by published evidence.
Liquid chromatography–mass spectrometry is common for identity and purity checks. High-performance liquid chromatography with ultraviolet detection can also be used. Both methods require a suitable reference standard.